Novus Biologicals
Manufacturer Code:NBP156848
Catalog # NBP156848
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PSPH(phosphoserine phosphatase) The peptide sequence was selected from the middle region of PSPH. Peptide sequence IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: L-3-phosphoserine phosphatase; L-3-phosphoserine phosphatase O-phosphoserine phosphohydrolase phosphoserine phosphatase PSPase PSPEC 3.1.3.3; O-phosphoserine phosphohydrolase; Phosphoserine phosphatase; PSP; PSPase
Gene Aliases: PSP; PSPH; PSPHD
UniProt ID: (Human) P78330
Entrez Gene ID: (Human) 5723
Molecular Function:
hydrolase
phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.