Novus Biologicals
Manufacturer Code:NBP157816
Catalog # NBP157816
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PLSCR1(phospholipid scramblase 1) Antibody(against the N terminal of PLSCR1. Peptide sequence MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Ca(2+)-dependent phospholipid scramblase 1; Erythrocyte phospholipid scramblase; Erythrocyte phospholipid scramblase MmTRA1b MMTRA1BCa(2+)-dependent phospholipid scramblase 1 phospholipid scramblase 1 PL scramblase 1; Mg(2+)-dependent nuclease; MmTRA1b; Phospholipid scramblase 1; PL scramblase 1
Gene Aliases: MMTRA1B; PLSCR1
UniProt ID: (Human) O15162
Entrez Gene ID: (Human) 5359
Molecular Function:
transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.