Novus Biologicals
Manufacturer Code:NBP15891820UL
Catalog # NBP15891820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PLCD1(phospholipase C delta 1) The peptide sequence was selected from the N terminal of PLCD1. Peptide sequence DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-1; 1-phosphatidylinositol-45-bisphosphate phosphodiesterase delta-1 EC 3.1.4.11 Phosphoinositide phospholipase C-delta-1 phospholipase C delta 1 Phospholipase C-delta-1 Phospholipase C-III PLC-delta-1 PLC-III; Phosphoinositide phospholipase C-delta-1; phospholipase C, delta 1; Phospholipase C-delta-1; Phospholipase C-III; PLC-delta-1; PLC-III
Gene Aliases: NDNC3; PLC-III; PLCD1
UniProt ID: (Human) P51178
Entrez Gene ID: (Human) 5333
Molecular Function:
G-protein modulator
calcium-binding protein
enzyme modulator
guanyl-nucleotide exchange factor
hydrolase
lipase
phospholipase
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.