Novus Biologicals
Manufacturer Code:NBP256992
Catalog # NBP256992
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DWRKFKLESQDSDSIPPSKKEILRQMSSPQSRNGKDSKERVSRKMSIQEYELI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 33 kDa phototransducing protein; 33 kDa phototransducing protein 33kDA phototransducing protein G beta gamma binding protein PHD PhLP phosducin phosducin-like orphan protein; G beta gamma binding protein; PHD; Phosducin; phosducin-like orphan protein; Protein MEKA
Gene Aliases: MEKA; PDC; PHD; PhLOP; PhLP
UniProt ID: (Human) P20941
Entrez Gene ID: (Human) 5132
Molecular Function:
G-protein modulator
chaperone
enzyme modulator
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.