Novus Biologicals
Manufacturer Code:NBP158348
Catalog # NBP158348
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PRDX5(peroxiredoxin 5) The peptide sequence was selected from the middle region of PRDX5. Peptide sequence TDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ACR1Peroxisomal antioxidant enzyme Alu corepressor 1 Alu co-repressor 1 Antioxidant enzyme B166 AOEB166Peroxiredoxin V B166 EC 1.11.1.15 Liver tissue 2D-page spot 71B MGC117264 MGC142283 MGC142285 peroxiredoxin 5 peroxiredoxin-5 mitochondrial PLPThioredoxin peroxidase PMP20 PMP20 PRDX6 prx-V PRXV SBBI10 Thioredoxin reductase TPx type VI; Alu co-repressor 1; Alu corepressor 1; Antioxidant enzyme B166; AOEB166; epididymis secretory protein Li 55; Liver tissue 2D-page spot 71B; Peroxiredoxin V; Peroxiredoxin-5, mitochondrial; Peroxisomal antioxidant enzyme; PLP; Prx-V; Thioredoxin peroxidase PMP20; thioredoxin reductase; Thioredoxin-dependent peroxiredoxin 5; TPx type VI
Gene Aliases: ACR1; AOEB166; B166; HEL-S-55; PLP; PMP20; PRDX5; PRDX6; prx-V; PRXV; SBBI10
UniProt ID: (Human) P30044
Entrez Gene ID: (Human) 25824
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.