Novus Biologicals
Manufacturer Code:NBP169318
Catalog # NBP169318
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PAM(peptidylglycine alpha-amidating monooxygenase) The peptide sequence was selected from the N terminal of PAM. Peptide sequence PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: PAL; PAL pancreatic peptidylglycine alpha-amidating monooxygenase peptidyl alpha-amidating enzyme peptidyl-alpha-hydroxyglycine alpha-amidating lyase peptidylamidoglycolate lyase peptidylglycine 2-hydroxylase peptidyl-glycine alpha-amidating monooxygenase peptidylglycine alpha-amidating monooxygenase peptidylglycine alpha-hydroxylating monooxygenase PHM; PAM; pancreatic peptidylglycine alpha-amidating monooxygenase; peptidyl alpha-amidating enzyme; Peptidyl-alpha-hydroxyglycine alpha-amidating lyase; Peptidyl-glycine alpha-amidating monooxygenase; Peptidylamidoglycolate lyase; peptidylglycine 2-hydroxylase; Peptidylglycine alpha-hydroxylating monooxygenase; PHM
Gene Aliases: PAL; PAM; PHM
UniProt ID: (Human) P19021
Entrez Gene ID: (Human) 5066
Molecular Function: oxidoreductase oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.