Novus Biologicals
Manufacturer Code:NBP256568
Catalog # NBP256568
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Nuclear receptor subfamily 1 group I member 2; nuclear receptor subfamily 1 group I member 2 nuclear receptor subfamily 1 group I member 2 ONR1 Orphan nuclear receptor PAR1 Orphan nuclear receptor PXR PAR PAR1 PAR2 Pregnane X receptor PRR PXRPARq SAR Steroid and xenobiotic receptor SXRBXR; nuclear receptor subfamily 1, group I, member 2; Orphan nuclear receptor PAR1; Orphan nuclear receptor PXR; pregnane X nuclear receptor variant 2; Pregnane X receptor; Steroid and xenobiotic receptor; SXR
Gene Aliases: BXR; NR1I2; ONR1; PAR; PAR1; PAR2; PARq; PRR; PXR; SAR; SXR
UniProt ID: (Human) O75469
Entrez Gene ID: (Human) 8856
Molecular Function:
nuclear hormone receptor
nucleic acid binding
receptor
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.