Novus Biologicals
Manufacturer Code:NBP155176
Catalog # NBP155176
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PWWP2B(PWWP domain containing 2B) The peptide sequence was selected from the N terminal of PWWP2B. Peptide sequence ILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQLGSSS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: bA432J24.1 FLJ39621 FLJ46823 pp8607 PWWP domain containing 2 PWWP domain containing 2B PWWP domain-containing protein 2B PWWP2 RP11-273H7.1; PWWP domain containing 2; PWWP domain-containing protein 2B
Gene Aliases: bA432J24.1; pp8607; PWWP2; PWWP2B
UniProt ID: (Human) Q6NUJ5
Entrez Gene ID: (Human) 170394
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.