Novus Biologicals
Manufacturer Code:NBP230613
Catalog # NBP230613
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LVKQEMGKQSLSLGRDDIVQLKEAYKWITHPLFSEELGVPIDGKSLFEVSVVFAHPETVEDCHFLAAICPDCFKPAKNKQSVFTRMAVMKA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CCDC139 coiled-coil domain containing 139 Coiled-coil domain-containing protein 139 DOBIMGC126729 EC 5.4.99 EC 5.4.99.- FLJ32312 MGC126755 pseudouridine synthase 10 pseudouridylate synthase 10 Psi55 synthase PUS1 putative tRNA pseudouridine synthase Pus10 tRNA pseudouridine 55 synthase tRNA pseudouridylate synthase tRNA-uridine isomerase; coiled-coil domain containing 139; Coiled-coil domain-containing protein 139; Hup10; pseudouridine synthase 10; Psi55 synthase; tRNA pseudouridine 55 synthase; tRNA pseudouridine synthase Pus10; tRNA pseudouridylate synthase; tRNA-uridine isomerase
Gene Aliases: CCDC139; DOBI; PUS10
UniProt ID: (Human) Q3MIT2
Entrez Gene ID: (Human) 150962
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.