Novus Biologicals
Manufacturer Code:NBP213827
Catalog # NBP213827
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWS PEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARAT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DUSP23 EC 3.1.3.16 EC 3.1.3.48 FLJ46081 MOSPNB4 apoptosis/differentiation related protein Phosphoinositide lipid phosphatase PLIPprotein-tyrosine phosphatase mitochondrial 1 protein tyrosine phosphatase mitochondrial 1 PTEN-like phosphatase; NB4 apoptosis/differentiation related protein; Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1; Phosphoinositide lipid phosphatase; Protein-tyrosine phosphatase mitochondrial 1; PTEN-like phosphatase
Gene Aliases: DUSP23; MOSP; PLIP; PNAS-129; PTPMT1
UniProt ID: (Human) Q8WUK0
Entrez Gene ID: (Human) 114971
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.