Novus Biologicals
Manufacturer Code:NBP159414
Catalog # NBP159414
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PTPLAD2(protein tyrosine phosphatase-like A domain containing 2) The peptide sequence was selected from the middle region of PTPLAD2. Peptide sequence LLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFW. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-hydroxyacyl-CoA dehydratase 4; DKFZp686F01145 DKFZp686G24132 EC 4.2.1.- Em:AL662879.1 HACD4 protein tyrosine phosphatase-like A domain containing 2 Protein tyrosine phosphatase-like protein PTPLAD23-hydroxyacyl-CoA dehydratase 4 Protein-tyrosine phosphatase-like A domain-containing protein 2; HACD4; protein tyrosine phosphatase-like A domain containing 2; protein tyrosine phosphatase-like protein PTPLAD2; Protein-tyrosine phosphatase-like A domain-containing protein 2; very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 4; Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4
Gene Aliases: HACD4; PTPLAD2
UniProt ID: (Human) Q5VWC8
Entrez Gene ID: (Human) 401494
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.