Novus Biologicals
Manufacturer Code:NBP159028
Catalog # NBP159028
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PTPLAD1(protein tyrosine phosphatase-like A domain containing 1) The peptide sequence was selected from the N terminal of PTPLAD1. Peptide sequence WLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-hydroxyacyl-CoA dehydratase 3; B-ind1; B-ind1 BIND1 Butyrate-induced protein 1 butyrate-induced transcript 1 EC 4.2.1.- FLJ90376 HACD3 hB-ind1 HSPC1213-hydroxyacyl-CoA dehydratase 3 protein tyrosine phosphatase-like A domain containing 1 Protein tyrosine phosphatase-like protein PTPLAD1 Protein-tyrosine phosphatase-like A domain-containing protein 1; Butyrate-induced protein 1; butyrate-induced transcript 1; HACD3; protein tyrosine phosphatase-like A domain containing 1; protein tyrosine phosphatase-like protein PTPLAD1; Protein-tyrosine phosphatase-like A domain-containing protein 1; very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 3; Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3
Gene Aliases: B-IND1; BIND1; HACD3; HSPC121; PTPLAD1
UniProt ID: (Human) Q9P035
Entrez Gene ID: (Human) 51495
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.