Novus Biologicals
Manufacturer Code:NBP184833
Catalog # NBP184833
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:AASVASRGHPAASPALPRLSDFRRRRSFRRIAGAEIQMV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EP4 EP4R MGC126583 PGE receptor EP4 subtype PGE receptor EP4 subtype PGE2 receptor EP4 subtype prostaglandin E receptor 4 (subtype EP4) prostaglandin E2 receptor EP4 subtype Prostanoid EP4 receptor PTGER2; PGE receptor EP4 subtype; PGE receptor, EP4 subtype; PGE2 receptor EP4 subtype; prostaglandin E receptor 4 (subtype EP4); Prostaglandin E2 receptor EP4 subtype; Prostanoid EP4 receptor
Gene Aliases: EP4; EP4R; PTGER2; PTGER4
UniProt ID: (Human) P35408
Entrez Gene ID: (Human) 5734
Molecular Function:
G-protein coupled receptor
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.