Novus Biologicals
Manufacturer Code:NBP184835
Catalog # NBP184835
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EP3EP3e EP3-I EP3-II EP3-III EP3-IV MGC141828 MGC141829 MGC27302 PGE receptor EP3 subtype PGE receptor EP3 subtype PGE2 receptor EP3 subtype PGE2-R prostaglandin E receotor EP3 subtype 3 isoform prostaglandin E receptor 3 (subtype EP3) prostaglandin E2 receptor EP3 subtype prostaglandin receptor (PGE-2) Prostanoid EP3 receptor; PGE receptor EP3 subtype; PGE receptor, EP3 subtype; PGE2 receptor EP3 subtype; PGE2-R; prostaglandin E receotor EP3 subtype 3 isoform; prostaglandin E receptor 3 (subtype EP3); Prostaglandin E2 receptor EP3 subtype; prostaglandin receptor (PGE-2); Prostanoid EP3 receptor
Gene Aliases: EP3; EP3-I; EP3-II; EP3-III; EP3-IV; EP3-VI; EP3e; PGE2-R; PTGER3
UniProt ID: (Human) P43115
Entrez Gene ID: (Human) 5733
Molecular Function: G-protein coupled receptor receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.