Novus Biologicals
Manufacturer Code:NBP179237
Catalog # NBP179237
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human PSMC3IPThe immunogen for this antibody is PSMC3IP. Peptide sequence RLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DBD-interacting; DBD-interacting GT198 GT198 alternative homologous-pairing protein 2 homolog HOP2 HUMGT198A Nuclear receptor coactivator GT198 Proteasome 26S ATPase subunit 3-interacting protein PSMC3 interacting protein Tat-binding protein 1-interacting protein TBP-1 interacting protein TBP-1-interacting protein TBPIPPSMC3-interacting protein; Homologous-pairing protein 2 homolog; Nuclear receptor coactivator GT198; Proteasome 26S ATPase subunit 3-interacting protein; PSMC3-interacting protein; Tat-binding protein 1-interacting protein; TBP-1-interacting protein
Gene Aliases: GT198; HOP2; HUMGT198A; ODG3; PSMC3IP; TBPIP
UniProt ID: (Human) Q9P2W1
Entrez Gene ID: (Human) 29893
Molecular Function: DNA binding protein enzyme modulator nucleic acid binding signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.