Novus Biologicals
Manufacturer Code:NBP19148220UL
Catalog # NBP19148220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human PRR5. Peptide sequence GLDPTRSSLPRSSPENLVDQILESVDSDSEGIFIDFGRGRGSGMSDLEGS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ20185 FLJ20185k proline rich 5 (renal) protein observed with Rictor-1; proline rich 5 (renal); Proline-rich protein 5; Protein observed with Rictor-1; Protor-1; Rho GTPase activating protein 8
Gene Aliases: FLJ20185k; PP610; PROTOR-1; PROTOR1; PRR5
UniProt ID: (Human) P85299
Entrez Gene ID: (Human) 55615
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.