Novus Biologicals
Manufacturer Code:NBP213813
Catalog # NBP213813
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LHASQIQVSVEAKYWCLKGGRKGLMMLKTAEKP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CMTX5ARTS deafness X-linked 2 perceptive congenital DFN2 DFNX1KIAA0967 dJ1070B1.2 (phosphoribosyl pyrophosphate synthetase 1) EC 2.7.6.1 Phosphoribosyl pyrophosphate synthase I phosphoribosyl pyrophosphate synthetase 1 PPRibP PRSI PRS-I ribose-phosphate diphosphokinase 1 ribose-phosphate pyrophosphokinase 1; deafness 2, perceptive, congenital; deafness, X-linked 2, perceptive, congenital; dJ1070B1.2 (phosphoribosyl pyrophosphate synthetase 1); Phosphoribosyl pyrophosphate synthase I; PPRibP; PRS-I; ribose-phosphate diphosphokinase 1; Ribose-phosphate pyrophosphokinase 1
Gene Aliases: ARTS; CMTX5; DFN2; DFNX1; PPRibP; PRPS1; PRS-I; PRSI
UniProt ID: (Human) P60891
Entrez Gene ID: (Human) 5631
Molecular Function: carbohydrate kinase kinase ligase nucleotide kinase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.