Novus Biologicals
Manufacturer Code:NBP183217
Catalog # NBP183217
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hPrp4; hPrp4 HPRP4P HPRP4PRP4/STK/WD splicing factor PRP4 homolog PRP4 pre-mRNA processing factor 4 homolog (yeast) Prp4p PRP4WD splicing factor Prp4 U4/U6 small nuclear ribonucleoprotein Prp4 U4/U6 snRNP 60 kDa protein; PRP4 homolog; PRP4 pre-mRNA processing factor 4 homolog; PRP4/STK/WD splicing factor; U4/U6 small nuclear ribonucleoprotein Prp4; U4/U6 snRNP 60 kDa protein; WD splicing factor Prp4
Gene Aliases: HPRP4; HPRP4P; PRP4; Prp4p; PRPF4; RP70; SNRNP60
UniProt ID: (Human) O43172
Entrez Gene ID: (Human) 9128
Molecular Function:
RNA binding protein
mRNA processing factor
mRNA splicing factor
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.