Novus Biologicals
Manufacturer Code:NBP257695
Catalog # NBP257695
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp566J153 hPrp31 NY-BR-99 Pre-mRNA-processing factor 31 Protein 61K PRP31 pre-mRNA processing factor 31 homolog (S. cerevisiae) PRP31 pre-mRNA processing factor 31 homolog (yeast) PRP31RP11 Serologically defined breast cancer antigen NY-BR-99 U4/U6 small nuclear ribonucleoprotein Prp31 U4/U6 snRNP 61 kDa protein; hPrp31; Pre-mRNA-processing factor 31; Protein 61K; PRP31 pre-mRNA processing factor 31 homolog; Serologically defined breast cancer antigen NY-BR-99; U4/U6 small nuclear ribonucleoprotein Prp31; U4/U6 snRNP 61 kDa protein
Gene Aliases: NY-BR-99; PRP31; PRPF31; RP11; SNRNP61
UniProt ID: (Human) Q8WWY3
Entrez Gene ID: (Human) 26121
Molecular Function:
RNA binding protein
mRNA processing factor
mRNA splicing factor
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.