Novus Biologicals
Manufacturer Code:NBP238864
Catalog # NBP238864
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hPso4; hPSO4 NMP200SNEV Nuclear matrix protein 200 nuclear matrix protein NMP200 related to splicing factor PRP19 pre-mRNA-processing factor 19 PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) PRP19PRP19/PSO4 homolog (S. cerevisiae) PSO4PRP19/PSO4 homolog Senescence evasion factor UBOX4; Nuclear matrix protein 200; nuclear matrix protein NMP200 related to splicing factor PRP19; Pre-mRNA-processing factor 19; PRP19/PSO4 homolog; PRP19/PSO4 pre-mRNA processing factor 19 homolog; psoralen 4; RING-type E3 ubiquitin transferase PRP19; Senescence evasion factor
Gene Aliases: hPSO4; NMP200; PRP19; PRPF19; PSO4; SNEV; UBOX4
UniProt ID: (Human) Q9UMS4
Entrez Gene ID: (Human) 27339
Molecular Function:
RNA binding protein
mRNA processing factor
mRNA splicing factor
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.