Novus Biologicals
Manufacturer Code:NBP170682
Catalog # NBP170682
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PRODH2(proline dehydrogenase (oxidase) 2) The peptide sequence was selected from the C terminal of PRODH2. Peptide sequence LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: HsPOX1; HSPOX1 kidney and liver proline oxidase 1 probable proline dehydrogenase 2 probable proline oxidase 2 proline dehydrogenase (oxidase) 2; Hydroxyproline dehydrogenase; HYPDH; Kidney and liver proline oxidase 1; Probable proline dehydrogenase 2; Probable proline oxidase 2; proline dehydrogenase (oxidase) 2
Gene Aliases: HSPOX1; HYPDH; PRODH2
UniProt ID: (Human) Q9UF12
Entrez Gene ID: (Human) 58510
Molecular Function:
oxidase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.