Novus Biologicals
Manufacturer Code:NBP15540120UL
Catalog # NBP1554020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PRMT8(protein arginine methyltransferase 8) The peptide sequence was selected from the C terminal of PRMT8 (NP_872294). Peptide sequence YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: arginine methyltransferase 8; EC 2.1.1 EC 2.1.1.- EC 2.1.1.77 Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4 HMT1 hnRNP methyltransferase-like 3 HMT1 hnRNP methyltransferase-like 3 (S. cerevisiae) HMT1 hnRNP methyltransferase-like 4 HMT1 hnRNP methyltransferase-like 4 (S. cerevisiae) HRMT1L3 HRMT1L4 protein arginine methyltransferase 8 protein arginine N-methyltransferase 4 protein arginine N-methyltransferase 8; Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4; HMT1 hnRNP methyltransferase-like 3; protein arginine N-methyltransferase 4; Protein arginine N-methyltransferase 8
Gene Aliases: HRMT1L3; HRMT1L4; PRMT8
UniProt ID: (Human) Q9NR22
Entrez Gene ID: (Human) 56341
Molecular Function:
methyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.