Novus Biologicals
Manufacturer Code:NBP156610
Catalog # NBP156610
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PRMT7(protein arginine methyltransferase 7) The peptide sequence was selected from the N terminal of PRMT7. Peptide sequence MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: [Myelin basic protein]-arginine N-methyltransferase PRMT7; [Myelin basic protein]-arginine N-methyltransferase PRMT7 EC 2.1.1 EC 2.1.1.125 EC 2.1.1.126 FLJ10640 Histone-arginine N-methyltransferase PRMT7 KIAA1933EC 2.1.1.- myelin basic protein-arginine N-methyltransferase protein arginine methyltransferase 7 protein arginine N-methyltransferase 7; Histone-arginine N-methyltransferase PRMT7; myelin basic protein-arginine N-methyltransferase; Protein arginine N-methyltransferase 7
Gene Aliases: KIAA1933; PRMT7
UniProt ID: (Human) Q9NVM4
Entrez Gene ID: (Human) 54496
Molecular Function: methyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.