Novus Biologicals
Manufacturer Code:NBP232459
Catalog # NBP232459
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: WKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAME |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.1.1.- EC 2.1.1.125 FLJ10559 FLJ51477 Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6 Histone-arginine N-methyltransferase PRMT6 HMT1 hnRNP methyltransferase-like 6 HMT1 hnRNP methyltransferase-like 6 (S. cerevisiae) HRMT1L6 protein arginine methyltransferase 6 protein arginine N-methyltransferase 6; Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6; Histone-arginine N-methyltransferase PRMT6; HMT1 hnRNP methyltransferase-like 6; Protein arginine N-methyltransferase 6
Gene Aliases: HRMT1L6; PRMT6
UniProt ID: (Human) Q96LA8
Entrez Gene ID: (Human) 55170
Molecular Function:
methyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.