Novus Biologicals
Manufacturer Code:NBP152944
Catalog # NBP152944
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PRMT2 (protein arginine methyltransferase 2) The peptide sequence was selected from the N terminal of PRMT2 (NP_001526). Peptide sequence ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.1.1.- EC 2.1.1.125 Histone-arginine N-methyltransferase PRMT2 HMT1 HMT1 (hnRNP methyltransferase S. cerevisiae)-like 1 HMT1 hnRNP methyltransferase-like 1 HMT1 hnRNP methyltransferase-like 1 (S. cerevisiae) HRMT1L1PRMT2 beta MGC111373 PRMT2 alpha PRMT2 gamma protein arginine methyltransferase 2 protein arginine N-methyltransferase 2; Histone-arginine N-methyltransferase PRMT2; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1; HMT1 hnRNP methyltransferase-like 1; PRMT2 alpha; PRMT2 beta; PRMT2 gamma; Protein arginine N-methyltransferase 2
Gene Aliases: HMT1; HRMT1L1; PRMT2
UniProt ID: (Human) P55345
Entrez Gene ID: (Human) 3275
Molecular Function:
methyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.