Novus Biologicals
Manufacturer Code:NBP238511
Catalog # NBP238511
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKDGSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGVICENTC |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 80K-H protein; advanced glycation end-product receptor 2; AGE-binding receptor 2; AGE-R280K-H protein G19P1AGE-binding receptor 2 glucosidase 2 subunit beta Glucosidase II subunit beta glucosidase II beta subunit hepatocystin PCLD PKCSH PLD1 Protein kinase C substrate 60.1 kDa protein heavy chain protein kinase C substrate 80K-H protein kinase C substrate 80 Kda protein; Glucosidase 2 subunit beta; Glucosidase II subunit beta; hepatocystin; PKCSH; Protein kinase C substrate 60.1 kDa protein heavy chain; protein kinase C substrate, 80 Kda protein
Gene Aliases: AGE-R2; G19P1; GIIB; PCLD; PKCSH; PLD1; PRKCSH; VASAP-60
UniProt ID: (Human) P14314
Entrez Gene ID: (Human) 5589
Molecular Function: enzyme modulator transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.