Novus Biologicals
Manufacturer Code:NBP188573
Catalog # NBP188573
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRC |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BMPG; BMPGeosinophil major basic protein bone marrow proteoglycan bone-marrow proteoglycan MBP1 MBPeosinophil granule major basic protein MGC14537 natural killer cell activator Proteoglycan 2 proteoglycan 2 preproprotein proteoglycan 2 bone marrow (natural killer cell activator eosinophil granulemajor basic protein); Bone marrow proteoglycan; bone-marrow proteoglycan; EMBP; Eosinophil granule major basic protein; eosinophil major basic protein; natural killer cell activator; Pregnancy-associated major basic protein; Proteoglycan 2; proteoglycan 2 preproprotein; proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein)
Gene Aliases: BMPG; MBP; MBP1; PRG2; proMBP
UniProt ID: (Human) P13727
Entrez Gene ID: (Human) 5553
Molecular Function: antibacterial response protein defense/immunity protein extracellular matrix protein extracellular matrix structural protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.