Novus Biologicals
Manufacturer Code:NBP17969720UL
Catalog # NBP17969720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is Prdm12. Peptide sequence MTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: PFM9 PR domain containing 12 PR domain zinc finger protein 12 PR domain-containing protein 12 PR-domain containing protein 12 PR-domain zinc finger protein 12; PR domain containing 12; PR domain zinc finger protein 12; PR domain-containing protein 12; PR-domain containing protein 12; PR-domain zinc finger protein 12
Gene Aliases: HSAN8; PFM9; PRDM12
UniProt ID: (Human) Q9H4Q4
Entrez Gene ID: (Human) 59335
Molecular Function:
DNA binding protein
centromere DNA-binding protein
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.