Novus Biologicals
Manufacturer Code:NBP157598
Catalog # NBP157598
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to GREM2 (gremlin 2 cysteine knot superfamily homolog (Xenopus laevis)) The peptide sequence was selected from the N terminal of GREM2)(50ug). Peptide sequence MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERW |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CKTSF1B2FLJ21195 Cysteine knot superfamily 1 BMP antagonist 2 DAN domain family member 3 DAND3Prdc gremlin 2 gremlin 2 cysteine knot superfamily homolog gremlin-2 PRDCgremlin 2 cysteine knot superfamily homolog (Xenopus laevis) Protein related to DAN and cerberus; Cysteine knot superfamily 1, BMP antagonist 2; DAN domain family member 3; gremlin 2, cysteine knot superfamily, homolog; Gremlin-2; Protein related to DAN and cerberus
Gene Aliases: CKTSF1B2; DAND3; GREM2; PRDC
UniProt ID: (Human) Q9H772
Entrez Gene ID: (Human) 64388
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.