Novus Biologicals
Manufacturer Code:NBP185563
Catalog # NBP185563
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ceroid-palmitoyl-palmitoyl-protein thioesterase 1; ceroid-palmitoyl-palmitoyl-protein thioesterase 1 CLN1EC 3.1.2.22 INCL Palmitoyl-protein hydrolase 1 palmitoyl-protein thioesterase 1 PPT PPT-1; Palmitoyl-protein hydrolase 1; Palmitoyl-protein thioesterase 1; PPT-1
Gene Aliases: CLN1; INCL; PPT; PPT1
UniProt ID: (Human) P50897
Entrez Gene ID: (Human) 5538
Molecular Function:
esterase
hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.