Novus Biologicals
Manufacturer Code:NBP213802
Catalog # NBP213802
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVT VCG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.1.3.16 Pp4 PP4C PP4protein phosphatase X catalytic subunit PPP4 PP-X PPXPPH3 protein phosphatase 4 (formerly X) catalytic subunit protein phosphatase 4 catalytic subunit Protein phosphatase X serine/threonine-protein phosphatase 4 catalytic subunit; PP-X; PP4C; protein phosphatase 4 (formerly X), catalytic subunit; protein phosphatase 4, catalytic subunit; Protein phosphatase X; protein phosphatase X, catalytic subunit; Serine/threonine-protein phosphatase 4 catalytic subunit
Gene Aliases: PP-X; PP4; PP4C; PPH3; PPP4; PPP4C; PPX
UniProt ID: (Human) P60510
Entrez Gene ID: (Human) 5531
Molecular Function:
calcium-binding protein
hydrolase
phosphatase
protein phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.