Novus Biologicals
Manufacturer Code:NBP186657
Catalog # NBP186657
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: calcineurin A beta; calcineurin A2; Calmodulin-dependent calcineurin A subunit beta isoform; Calmodulin-dependent calcineurin A subunit beta isoform CALNA2protein phosphatase 3 (formerly 2B) catalytic subunit beta isoform(calcineurin A beta) CAM-PRP catalytic subunit CNA2catalytic subunit beta isoform EC 3.1.3.16 protein phosphatase 2B catalytic subunit beta isoform protein phosphatase 3 catalytic subunit beta isozyme protein phosphatase from PCR fragment H32 serine/threonine-protein phosphatase 2B catalytic subunit beta isoform; CAM-PRP catalytic subunit; CNA beta; protein phosphatase 2B, catalytic subunit, beta isoform; protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform; protein phosphatase 3, catalytic subunit, beta isozyme; protein phosphatase from PCR fragment H32; Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
Gene Aliases: CALNA2; CALNB; CNA2; PP2Bbeta; PPP3CB
UniProt ID: (Human) P16298
Entrez Gene ID: (Human) 5532
Molecular Function: calcium-binding protein hydrolase phosphatase protein phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.