Novus Biologicals
Manufacturer Code:NBP188958
Catalog # NBP188958
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B56B FLJ35411 PP2A B subunit isoform B56-beta PP2A B subunit isoform B'-beta PP2A B subunit isoform PR61-beta PP2A B subunit isoform R5-beta PR61B protein phosphatase 2 regulatory subunit B (B56) beta isoform protein phosphatase 2 regulatory subunit B' beta protein phosphatase 2 regulatory subunit B' beta isoform serine/threonine protein phosphatase 2A 56 kDa regulatory subunit betaisoform serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform; PP2A B subunit isoform B'-beta; PP2A B subunit isoform B56-beta; PP2A B subunit isoform PR61-beta; PP2A B subunit isoform R5-beta; protein phosphatase 2 regulatory subunit B', beta; protein phosphatase 2, regulatory subunit B', beta isoform; serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, beta isoform; Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform
Gene Aliases: B56B; PPP2R5B; PR61B
UniProt ID: (Human) Q15173
Entrez Gene ID: (Human) 5526
Molecular Function:
hydrolase
phosphatase
protein phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.