Novus Biologicals
Manufacturer Code:NBP15366320UL
Catalog # NBP15366320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PPP2R5A(protein phosphatase 2 regulatory subunit B' alpha isoform) The peptide sequence was selected from the N terminal of PPP2R5A. Peptide sequence YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B56A MGC131915 PP2A B subunit isoform B56-alpha PP2A B subunit isoform B'-alpha PP2A B subunit isoform PR61-alpha PP2A B subunit isoform R5-alpha PP2A B subunit B' alpha isoform PP2A B subunit B56 alpha isoform PP2A B subunit PR61 alpha isoform PP2A B subunit R5 alpha isoform PR61A PR61alpha protein phosphatase 2 regulatory subunit B (B56) alpha isoform protein phosphatase 2 regulatory subunit B' alpha protein phosphatase 2 regulatory subunit B' alpha isoform serine/threonine protein phosphatase 2A 56 kDa regulatory subunit alphaisoform serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform; PP2A B subunit isoform B'-alpha; PP2A B subunit isoform B56-alpha; PP2A B subunit isoform PR61-alpha; PP2A B subunit isoform R5-alpha; PP2A, B subunit, B' alpha isoform; PP2A, B subunit, B56 alpha isoform; PP2A, B subunit, PR61 alpha isoform; PP2A, B subunit, R5 alpha isoform; PR61alpha; protein phosphatase 2 regulatory subunit B', alpha; protein phosphatase 2, regulatory subunit B (B56), alpha isoform; protein phosphatase 2, regulatory subunit B', alpha isoform; serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, alpha isoform; Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
Gene Aliases: B56A; PPP2R5A; PR61A
UniProt ID: (Human) Q15172
Entrez Gene ID: (Human) 5525
Molecular Function:
hydrolase
phosphatase
protein phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.