Novus Biologicals
Manufacturer Code:NBP182243
Catalog # NBP182243
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ14005 FLJ34675 GL Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL PPP1R4PP1 subunit R4 protein phosphatase 1 regulatory subunit 3B Protein phosphatase 1 regulatory subunit 4 Protein phosphatase 1 subunit GL protein phosphatase 1 regulatory (inhibitor) subunit 3B; Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL; hepatic glycogen-targeting subunit, G(L); PP1 subunit R4; Protein phosphatase 1 regulatory subunit 3B; Protein phosphatase 1 regulatory subunit 4; Protein phosphatase 1 subunit GL; protein phosphatase 1, regulatory (inhibitor) subunit 3B; protein phosphatase 1, regulatory subunit 3B; PTG
Gene Aliases: GL; PPP1R3B; PPP1R4; PTG
UniProt ID: (Human) Q86XI6
Entrez Gene ID: (Human) 79660
Molecular Function:
enzyme modulator
phosphatase modulator
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.