Novus Biologicals
Manufacturer Code:NBP213794
Catalog # NBP213794
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDV HIKDITIHANP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Cyclophilin J; Cyclophilin J cyclophilin-like protein 3 Cyclophilin-like protein PPIL3 CyPJ EC 5.2.1.8 peptidyl-prolyl cis-trans isomerase-like 3 peptidylprolyl cis-trans isomerase-like protein 3 peptidylprolyl isomerase (cyclophilin)-like 3 PPIase PPIase-like protein 3 Rotamase PPIL3; cyclophilin-like protein 3; Cyclophilin-like protein PPIL3; CyPJ; Peptidyl-prolyl cis-trans isomerase-like 3; peptidylprolyl cis-trans isomerase-like protein 3; peptidylprolyl isomerase (cyclophilin)-like 3; peptidylprolyl isomerase -like 3; PPIase; PPIase-like protein 3; Rotamase PPIL3
Gene Aliases: CYPJ; PPIL3
UniProt ID: (Human) Q9H2H8
Entrez Gene ID: (Human) 53938
Molecular Function: isomerase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.