Novus Biologicals
Manufacturer Code:NBP182825
Catalog # NBP182825
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:IAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Dri42 EC 3.1.3.4 lipid phosphate phosphohydrolase 3 LPP3PAP2 beta MGC15306 PAP-2b PAP2B PAP2-beta Phosphatidate phosphohydrolase type 2b Phosphatidic acid phosphatase 2b phosphatidic acid phosphatase type 2B type-2 phosphatidic acid phosphatase-beta vascular endothelial growth factor and type I collagen inducible Vascular endothelial growth factor and type I collagen-inducible protein VCIP; Lipid phosphate phosphohydrolase 3; PAP-2b; PAP2 beta; PAP2-beta; Phosphatidate phosphohydrolase type 2b; Phosphatidic acid phosphatase 2b; phosphatidic acid phosphatase type 2B; Phospholipid phosphatase 3; type-2 phosphatidic acid phosphatase-beta; vascular endothelial growth factor and type I collagen inducible; Vascular endothelial growth factor and type I collagen-inducible protein; VCIP
Gene Aliases: Dri42; LPP3; PAP2B; PLPP3; PPAP2B; VCIP
UniProt ID: (Human) O14495
Entrez Gene ID: (Human) 8613
Molecular Function:
hydrolase
phosphatase
pyrophosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.