Novus Biologicals
Manufacturer Code:NBP189781
Catalog # NBP189781
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alpha uterine protein; alpha uterine protein GdF GdS glycodelin glycodelin-A glycodelin-F glycodelin-S MGC138509 MGC142288 PEP Placental protein 14 PP14 protein (placental protein 14) PP14GDPAEGGdA pregnancy-associated endometrial a Pregnancy-associated endometrial alpha-2 globulin pregnancy-associated endometrial alpha-2-globulin progestagen-associated endometrial protein (placental protein 14 progestagen-associated endometrial proteinPEG Progesterone-associated endometrial protein; GD; Glycodelin; glycodelin-A; glycodelin-F; glycodelin-S; PAEG; PEG; Placental protein 14; PP14; PP14 protein (placental protein 14); Pregnancy-associated endometrial alpha-2 globulin; pregnancy-associated endometrial alpha-2-globulin; Progestagen-associated endometrial protein; progestagen-associated endometrial protein (placental protein 14, pregnancy-associated endometrial a; Progesterone-associated endometrial protein; ZIF-1; Zona-binding inhibitory factor-1
Gene Aliases: GD; GdA; GdF; GdS; PAEG; PAEP; PEP; PP14
UniProt ID: (Human) P09466
Entrez Gene ID: (Human) 5047
Molecular Function:
isomerase
transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.