Novus Biologicals
Manufacturer Code:NBP17932220UL
Catalog # NBP17932220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is Porcn. Peptide sequence VAMKAVSLGFDLDRGEVGAVPSPVEFMGYLYFVGTIVFGPWISFHSYLQA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2410004O13Rik DHOF EC 2.3.1.- FODH MG61PPNprobable protein-cysteine N-palmitoyltransferase porcupine por PORCMGC29687 porcupine homolog (Drosophila) Protein MG61; probable protein-cysteine N-palmitoyltransferase porcupine; Protein MG61; Protein-serine O-palmitoleoyltransferase porcupine
Gene Aliases: DHOF; FODH; MG61; PORC; PORCN; PPN
UniProt ID: (Human) Q9H237
Entrez Gene ID: (Human) 64840
Molecular Function: acetyltransferase membrane traffic protein membrane trafficking regulatory protein transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.