Novus Biologicals
Manufacturer Code:NBP192282
Catalog # NBP192282
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:HGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 0610037N12Rik EC 3.1.26.5 hPOP7 processing of precursor 7 ribonuclease P subunit processing of precursor 7 ribonuclease P subunit (S. cerevisiae) processing of precursor 7 ribonuclease P/MRP subunit (S. cerevisiae) ribonuclease P protein subunit p20 Ribonucleases P/MRP protein subunit POP7 homolog RNaseP protein p20 RPP20S. cerevisiae) homolog; hPOP7; POP7 (processing of precursor, S. cerevisiae) homolog; processing of precursor 7, ribonuclease P subunit; processing of precursor 7, ribonuclease P/MRP subunit; Ribonuclease P protein subunit p20; Ribonucleases P/MRP protein subunit POP7 homolog; RNaseP protein p20
Gene Aliases: 0610037N12Rik; POP7; RPP2; RPP20
UniProt ID: (Human) O75817
Entrez Gene ID: (Human) 10248
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.