Novus Biologicals
Manufacturer Code:NBP169633
Catalog # NBP169633
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PON3(paraoxonase 3) The peptide sequence was selected from the middle region of PON3. Peptide sequence PMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: arylesterase 3; EC 3.1.1.2 EC 3.1.1.81 EC 3.1.8.1 paraoxanase-3 paraoxonase 3 serum paraoxonase/lactonase 3; paraoxanase-3; Serum paraoxonase/lactonase 3
Gene Aliases: PON3
UniProt ID: (Human) Q15166
Entrez Gene ID: (Human) 5446
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.