Novus Biologicals
Manufacturer Code:NBP17410820UL
Catalog # NBP17410820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the N terminal of Pomgnt1. Immunizing peptide sequence LLVTVIVNIKLILDTRRAISEANEDPEPEQDYDEALGRLESPRRRGSSPR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp761B182 EC 2.4.1 EC 2.4.1.- EC 2.4.1.101 FLJ20277 GnT I.2 MDDGA3 MDDGB3 MDDGC3 MEB MGAT1.2GNTI.2 POMGnT1 protein O-linked mannose beta12-N-acetylglucosaminyltransferase protein O-linked-mannose beta-12-N-acetylglucosaminyltransferase 1 UDP-GlcNAc:alpha-D-mannoside beta-12-N-acetylglucosaminyltransferase I.2; GnT I.2; POMGnT1; Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1; UDP-GlcNAc:alpha-D-mannoside beta-1,2-N-acetylglucosaminyltransferase I.2
Gene Aliases: GnT I.2; gnT-I.2; GNTI.2; LGMD2O; MEB; MGAT1.2; POMGNT1; UNQ746/PRO1475
UniProt ID: (Human) Q8WZA1
Entrez Gene ID: (Human) 55624
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.