Novus Biologicals
Manufacturer Code:NBP153025
Catalog # NBP153025
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to POLR3H(polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)) The peptide sequence was selected from the middle region of POLR3H. Peptide sequence AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DNA-directed RNA polymerase III subunit 22.9 kDa polypeptide; DNA-directed RNA polymerase III subunit 22.9 kDa polypeptide DNA-directed RNA polymerase III subunit H DNA-directed RNA polymerase III subunit RPC8 KIAA1665MGC29654 MGC111097 polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) RNA nucleotidyltransferase (DNA-directed) RNA polymerase III subunit 22.9 kDa subunit RNA polymerase III subunit C8 RNA polymerase III subunit RPC8 RPC8RPC22.9; DNA-directed RNA polymerase III subunit H; DNA-directed RNA polymerase III subunit RPC8; polymerase (RNA) III (DNA directed) polypeptide H (22.9kD); polymerase (RNA) III subunit H; RNA nucleotidyltransferase (DNA-directed); RNA polymerase III subunit 22.9 kDa subunit; RNA polymerase III subunit C8; RPC22.9
Gene Aliases: KIAA1665; POLR3H; RPC22.9; RPC8
UniProt ID: (Human) Q9Y535
Entrez Gene ID: (Human) 171568
Molecular Function:
DNA-directed RNA polymerase
RNA binding protein
nucleic acid binding
nucleotidyltransferase
transcription factor
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.