Novus Biologicals
Manufacturer Code:NBP181997
Catalog # NBP181997
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYSD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alternative RNA polymerase III subunit 32; alternative RNA polymerase III subunit 32 DNA-directed RNA polymerase III subunit G-like DNA-directed RNA polymerase III subunit RPC7-like flj32422 FLJ34890 MGC3200 polymerase (RNA) III (DNA directed) polypeptide G (32kD) like polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like RNA polymerase III subunit C7-like RPC32HOM RPC32-like protein; DNA-directed RNA polymerase III subunit G-like; DNA-directed RNA polymerase III subunit RPC7-like; polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like; polymerase (RNA) III subunit G like; RNA polymerase III 32 kDa beta subunit; RNA polymerase III subunit C7-like; RPC32-beta; RPC32-like protein
Gene Aliases: flj32422; POLR3GL; RPC32HOM
UniProt ID: (Human) Q9BT43
Entrez Gene ID: (Human) 84265
Molecular Function: DNA-directed RNA polymerase RNA binding protein nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.