Novus Biologicals
Manufacturer Code:NBP256240
Catalog # NBP256240
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BN51 (BHK21) temperature sensitivity complementing; BN51 BN51 (BHK21) temperature sensitivity complementing BN51TDNA-directed RNA polymerase III 47 kDa polypeptide DNA-directed RNA polymerase III subunit D DNA-directed RNA polymerase III subunit RPC4 polymerase (RNA) III (DNA directed) polypeptide D 44kDa Protein BN51 RNA polymerase III 47 kDa subunit RNA polymerase III subunit C4 RPC4 RPC53 homolog temperature sensitive complementation cell cycle specific tsBN51 TSBN51RPC53; DNA-directed RNA polymerase III 47 kDa polypeptide; DNA-directed RNA polymerase III subunit D; DNA-directed RNA polymerase III subunit RPC4; polymerase (RNA) III (DNA directed) polypeptide D, 44kDa; polymerase (RNA) III subunit D; Protein BN51; RNA polymerase III 47 kDa subunit; RNA polymerase III subunit C4; RPC53 homolog; temperature sensitive complementation, cell cycle specific, tsBN51
Gene Aliases: BN51; BN51T; POLR3D; RPC4; RPC53; TSBN51
UniProt ID: (Human) P05423
Entrez Gene ID: (Human) 661
Molecular Function: DNA-directed RNA polymerase RNA binding protein nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.