Novus Biologicals
Manufacturer Code:NBP15305120UL
Catalog # NBP1530520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to POLR3A(polymerase (RNA) III (DNA directed) polypeptide A 155kDa) The peptide sequence was selected from the middle region of POLR3A (NP_008986). Peptide sequence AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DNA-directed RNA polymerase III largest subunit; DNA-directed RNA polymerase III largest subunit DNA-directed RNA polymerase III subunit A DNA-directed RNA polymerase III subunit RPC1 EC 2.7.7.6 hRPC155 POL3A polymerase (RNA) III (DNA directed) polypeptide A 155kDa RNA polymerase III 155 kDa subunit RNA polymerase III subunit C160 RNA polymerase III subunit RPC155-D RPC1 RPC155RNA polymerase III subunit C1; DNA-directed RNA polymerase III subunit A; DNA-directed RNA polymerase III subunit RPC1; polymerase (RNA) III (DNA directed) polypeptide A, 155kDa; polymerase (RNA) III subunit A; RNA polymerase III 155 kDa subunit; RNA polymerase III subunit C1; RNA polymerase III subunit C160; RNA polymerase III subunit RPC155-D; RPC155
Gene Aliases: ADDH; HLD7; hRPC155; POLR3A; RPC1; RPC155
UniProt ID: (Human) O14802
Entrez Gene ID: (Human) 11128
Molecular Function:
DNA-directed RNA polymerase
RNA binding protein
nucleic acid binding
nucleotidyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.