Novus Biologicals
Manufacturer Code:NBP180817
Catalog # NBP180817
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DNA-directed RNA polymerase II 33 kDa polypeptide; DNA-directed RNA polymerase II 33 kDa polypeptide DNA-directed RNA polymerase II subunit C DNA-directed RNA polymerase II subunit RPB3 hRPB33 hsRPB3 polymerase (RNA) II (DNA directed) polypeptide C (33kD) polymerase (RNA) II (DNA directed) polypeptide C 33kDa RNA polymerase II subunit 3 RNA polymerase II subunit B3 RPB3 RPB31 RPB33; DNA-directed RNA polymerase II subunit C; DNA-directed RNA polymerase II subunit RPB3; polymerase (RNA) II (DNA directed) polypeptide C, 33kDa; polymerase (RNA) II subunit C; RNA polymerase II subunit 3; RNA polymerase II subunit B3; RPB31; RPB33
Gene Aliases: A-152E5.7; hRPB33; hsRPB3; POLR2C; RPB3; RPB31
UniProt ID: (Human) P19387
Entrez Gene ID: (Human) 5432
Molecular Function: DNA-directed RNA polymerase RNA binding protein nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.