Novus Biologicals
Manufacturer Code:NBP153191
Catalog # NBP153191
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to POLR1B (polymerase (RNA) I polypeptide B 128kDa) The peptide sequence was selected from the middle region of POLR1B)(50ug). Peptide sequence SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DNA-directed RNA polymerase I 135 kDa polypeptide; DNA-directed RNA polymerase I 135 kDa polypeptide DNA-directed RNA polymerase I 135kDa polypeptide DNA-directed RNA polymerase I subunit RPA2 EC 2.7.7.6 FLJ10816 FLJ21921 MGC131780 polymerase (RNA) I polypeptide B 128kDa RNA polymerase I subunit 2 RPA116 RPA135 RPA2 Rpo1-2; DNA-directed RNA polymerase I 135kDa polypeptide; DNA-directed RNA polymerase I subunit RPA2; polymerase (RNA) I polypeptide B; polymerase (RNA) I polypeptide B, 128kDa; polymerase (RNA) I subunit B; RNA polymerase I subunit 2; RPA135
Gene Aliases: POLR1B; RPA135; RPA2; Rpo1-2
UniProt ID: (Human) Q9H9Y6
Entrez Gene ID: (Human) 84172
Molecular Function:
DNA-directed RNA polymerase
RNA binding protein
nucleic acid binding
nucleotidyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.