Novus Biologicals
Manufacturer Code:NBP180103
Catalog # NBP180103
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human KCTD13. Peptide sequence PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BACURD1 BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1 BTB/POZ domain-containing protein KCTD13 hBACURD1 PDIP1FKSG86 POLDIP1TNFAIP1-like protein Polymerase delta-interacting protein 1 potassium channel tetramerisation domain containing 13; BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1; BTB/POZ domain-containing protein KCTD13; CTD-2574D22.4; hBACURD1; Polymerase delta-interacting protein 1; potassium channel tetramerisation domain containing 13; TNFAIP1-like protein
Gene Aliases: BACURD1; FKSG86; hBACURD1; KCTD13; PDIP1; POLDIP1; PP6832
UniProt ID: (Human) Q8WZ19
Entrez Gene ID: (Human) 253980
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.