Novus Biologicals
Manufacturer Code:NBP15805420UL
Catalog # NBP15805420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to POFUT2(protein O-fucosyltransferase 2) The peptide sequence was selected from the N terminal of POFUT2. Peptide sequence GAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C21orf80 chromosome 21 open reading frame 80 FUT13EC 2.4.1.221 GDP-fucose protein O-fucosyltransferase 2 KIAA0958 O-FucT-2 Peptide-O-fucosyltransferase 2 protein O-fucosyltransferase 2; GDP-fucose protein O-fucosyltransferase 2; O-FucT-2; Peptide-O-fucosyltransferase 2
Gene Aliases: C21orf80; FUT13; KIAA0958; POFUT2
UniProt ID: (Human) Q9Y2G5
Entrez Gene ID: (Human) 23275
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.